PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan014950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family EIL
Protein Properties Length: 445aa    MW: 49460.1 Da    PI: 5.0147
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-131141PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3306.67.6e-94325080323
                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--H CS
       EIN3  80 kgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkel 179
                ++kpv+g+sd+LraWWkekv+fd+ngpaai+ky+a++++ +++ ++  ++ + ++ l++lqD+tlgSLLs+lmqhcdppqr+fplekg++pPWWPtG+e+
  Aan014950   3 SSKPVSGSSDNLRAWWKEKVKFDKNGPAAIAKYDADCIAKGQGVGC--QNGNPNSILQDLQDATLGSLLSSLMQHCDPPQRKFPLEKGLPPPWWPTGDED 100
                68*********************************99999988888..56888899******************************************** PP

                HHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...........XXX CS
       EIN3 180 wwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...........slr 268
                ww +lgl+k q+ ppykkphdlkk+wkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes ++lsvl++ee+++ + s ++             l 
  Aan014950 101 WWTRLGLPKGQS-PPYKKPHDLKKMWKVGVLTAVIKHMSPNIAKIRRLVRQSKCLQDKMTAKESSIWLSVLGREEALVLQSSGDNAgsgitetpsggCL- 198
                ************.9****************************************************************999999555567666543322. PP

                XXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3 269 kqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvssk 323
                 ++++   s ++++dveg ++ + ++v+++++     v++k+k ++++++k  + 
  Aan014950 199 -DKNRPSNSYDSDYDVEGVEDAR-ASVSSKDRDPPSRVNDKKK-PSGKRQKRDTA 250
                .677778888899****988888.4566666667777777777.78877776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.3E-874174No hitNo description
Gene3DG3DSA:1.10.3180.101.3E-7054180IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.68E-6256177IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
RVSSKPVSGS SDNLRAWWKE KVKFDKNGPA AIAKYDADCI AKGQGVGCQN GNPNSILQDL  60
QDATLGSLLS SLMQHCDPPQ RKFPLEKGLP PPWWPTGDED WWTRLGLPKG QSPPYKKPHD  120
LKKMWKVGVL TAVIKHMSPN IAKIRRLVRQ SKCLQDKMTA KESSIWLSVL GREEALVLQS  180
SGDNAGSGIT ETPSGGCLDK NRPSNSYDSD YDVEGVEDAR ASVSSKDRDP PSRVNDKKKP  240
SGKRQKRDTA KQRDGLQLDI NQIGVSLSDF PVQENISIPE EHTLTSVGPL LVDTGSEPTI  300
PENEIPPDMI MYQPISESEY RPTPTGVHHG PQNSEFHNLV PYSLYTPPID VQQQQQQQQQ  360
QPVNEYQNEI VNPIPNGLQH LEKDGFHNEH HERPVDNQFE TSINSLSLDY GGFSSPFDLG  420
IDGTTSLDTD FDFLLDDDLI SYFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-725618611140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008450447.11e-137PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
RefseqXP_008450448.11e-138PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2
SwissprotO231161e-112EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A075EB471e-145A0A075EB47_ACTCH; EIN3-like protein EIL4
STRINGGLYMA15G03650.11e-130(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-113ETHYLENE-INSENSITIVE3-like 3